| Product Name | MECP2 Human |
|---|---|
| Product description | MECP2 Human Recombinant is expressed in 293 cells. The protein contains 486 amino acids (1-486a.a.) and fused to an N-terminal Flag tag, having an Mw of 53.56kDa. |
| Source | Mammalian system, 293 cells. |
| Sequence Similarities | MVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSA |
| Storage Instructions | MECP2 although stable 4°C for 4 weeks, should be stored below -18°C. |
| Storage Buffer | The MECP2 solution (0.45mg/ml) contains 50mM Tris, 135mM NaCl, 20% Glycerol, pH 7.5 and 200µg/ml FLAG peptide. |
