| Product Name | TNNI3 Human |
|---|---|
| Product description | Recombinant Human TNNI3 produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 210 amino acids and having a molecular mass of 24,016 Dalton. |
| Source | Escherichia Coli. |
| Sequence Similarities | MADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLKTLLLQ |
| Storage Instructions | Store at 4°C if entire vial will be used within 2-4 weeks. Store, frozen at -20°C for longer periods of time. |
| Storage Buffer | TNNI3 solution containing 6M Urea 50mM Tris PH 8. |
