| Product Name | MICA Human |
|---|---|
| Product description | MICA Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 320 amino acids and having a molecular mass of 36kDa. |
| Source | Escherichia Coli. |
| Sequence Similarities | EPHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQ |
| Storage Instructions | Lyophilized MICA although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MICA should be stored at 4°C between 2-7 days and for future use below -18°C. |
| Storage Buffer | Lyophilized from a concentrated (1mg/ml) solution containing no additives. |
