| Product Name | MX1 Bovine |
|---|---|
| Product description | MX1 Bovine Recombinant fused with a 20 amino acid His tag at N-terminus produced in E.Coli is a single, non-glycosylated, polypeptide chain (1-648 a.a) containing a total of 668 amino acids and having a molecular mass of 77kDa. |
| Source | Escherichia Coli. |
| Sequence Similarities | MVHSDLGIEELDSPESSLNGSEDMESKSNLYSQYEEKVRPCID |
| Storage Instructions | Lyophilized MX1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MX1 should be stored at 4°C between 2-7 days and for future use below -18°C. |
| Storage Buffer | The MX1 protein was lyophilized from a (1mg/ml) 0.2µm filtered solution containing 20mM Tris-HCl, pH7.9, 500mM NaCl, 0.5mM Imidazole, 0.1mM DTT and 6M urea. |
