| Product Name | MOG Human |
|---|---|
| Product description | Myelin Oligodendrocyte Glycoprotein produced in E.Coli is a single, non-glycosylated polypeptide chain containing a total of 132 amino acids (Met + 30-154 a.a. + 6x His tag at C-terminus) and having a total molecular mass of 15.2 kDa. |
| Source | Escherichia Coli. |
| Sequence Similarities | MGQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRN |
| Storage Instructions | Lyophilized MOG although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MOG should be stored at 4°C between 2-7 days and for future use below -18°C. |
| Storage Buffer | The Myelin Oligodendrocyte Glycoprotein 0.5mg/ml solution was lyophilized from 20mM sodium acetate buffer pH-4 and 0.3M sodium chloride. |
