| Product Name | RB1 Human |
|---|---|
| Product description | Retinoblastoma Human Recombinant fused with 6X His tag produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 146 amino acids and having a molecular mass of 16.5 kDa. |
| Source | Escherichia Coli. |
| Sequence Similarities | MASFPSSPLRIPGGNIYISPLKSPYKISEGLPTPTKMTPRSRILVSIGESFG |
| Storage Instructions | Lyophilized Retinoblastoma although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Retinoblastoma should be stored at 4°C between 2-7 days and for future use below -18°C. |
| Storage Buffer | The RB1 (1 mg/ml) was lyophilized after extensive dialyses against 1xPBS pH-7.4. |
