| Product Name | SELE Human, HEK |
|---|---|
| Product description | SELE Human Recombinant produced by mammalian expression system in human cells is a single polypeptide chain containing 543 amino acids (22-556). SELE is fused to an 8 amino acid His-tag at C-terminus is purified by proprietary chromatographic techniques. |
| Source | HEK293 cells. |
| Sequence Similarities | WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVW |
| Storage Instructions | Lyophilized SELE although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution SELE should be stored at 4°C between 2-7 days and for future use below -18°C. Please prevent freeze-thaw cycles. |
| Storage Buffer | SELE was lyophilized from a 0.2 µM filtered solution of PBS and 4% Mannitol, pH 7.5. |
