| Product Name | SDC4 Human, His |
|---|---|
| Product description | Syndecan-4 Human Recombinant fused with 6X His tag produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 140 amino acids and having a molecular mass of 15.4 kDa. The SDC4 is purified by proprietary chromatographic techniques. |
| Source | Escherichia Coli. |
| Sequence Similarities | MASIRETEVIDPQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGD |
| Storage Instructions | Lyophilized SDC4 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution SDC4 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles. |
| Storage Buffer | The SDC4 (1 mg/ml) was lyophilized after extensive dialyses against 20mM PBS pH-7.4. |
