Application
IHC analysis of rat kidney with (left) or without (right) Kir1.1 / ROMK antibody.Application
WB analysis of rat kidney lysates using Kir1.1 / ROMK antibody at a dilution of 1:200 in the (1) absence or (2) presence of blocking peptide.| Product Name | Kir1.1 / ROMK antibody |
|---|---|
| Antibody Type | Primary Antibodies |
| Product description | Rabbit Polyclonal antibody to Kir1.1 / ROMKpotassium channel involved in K+ secretion in the renal distal nephron [RGD, Feb 2006] |
| Immunogen | GST fusion protein with sequence HNFGKTVEVETPHCAMCLYNEKDARARMKRGYDNPNFVLSEVDET DDTQM, corresponding to amino acids 342-391 of rat ROMK1 (Accession P35560), (MW: 33 kDa). Intracellular, C-terminus. |
| Clonality | Polyclonal |
|---|---|
| Host Species | Rabbit |
| Tested Applications | ICC/IFIHCIPWB |
| Species Reactivity | HumanMouseRat |
| Concentration | 1mg/ml |
| Purification | Affinity purified |
| Gene Synonyms | potassium inwardly-rectifying channel, subfamily J, member 1 , Kcnj1 , ROMK1 , Kcnj |
|---|---|
| Target | Kir1.1 / ROMK |
Application
IHC analysis of rat kidney with (left) or without (right) Kir1.1 / ROMK antibody.
Application
WB analysis of rat kidney lysates using Kir1.1 / ROMK antibody at a dilution of 1:200 in the (1) absence or (2) presence of blocking peptide.| Form | Liquid |
|---|---|
| Storage Instructions | Keep as concentrated solution. Aliquot and store at -20ºC or below. Avoid multiple freeze-thaw cycles. |
| Storage Buffer | Phosphate buffered saline (PBS), pH 7.4, 1% BSA and 0.025% NaN3. |
