Application
WB analysis of rat brain membranes using Kv1.1 antibody at a dilution of 1:200 in the (1) absence or (2) presence of blocking peptide.| Product Name | Kv1.1 antibody |
|---|---|
| Antibody Type | Primary Antibodies |
| Product description | Rabbit Polyclonal antibody to Kv1.1 |
| Immunogen | GST fusion protein with sequence HRETEGEEQAQLLHV SSPNLASDSDLSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIRTGN CTTADQNCVNKSKLLTDV, corresponding to amino acid residues 416-495 of mouse Kv1.1 (Accession P16388), (MW: 36 kDa.). Intracellular, C-terminus. |
| Clonality | Polyclonal |
|---|---|
| Host Species | Rabbit |
| Tested Applications | ICC/IFIHCIPWB |
| Species Reactivity | HumanMouseRat |
| Concentration | 1mg/ml |
| Purification | Affinity purified |
| Gene Synonyms | MBK1 , Kcna1 , AI840627 , Mk-1 , Shak , Kca1-1 , mceph , potassium voltage-gated channel, shaker-related subfamily, member 1 |
|---|---|
| Target | Kv1.1 |
Application
WB analysis of rat brain membranes using Kv1.1 antibody at a dilution of 1:200 in the (1) absence or (2) presence of blocking peptide.| Form | Liquid |
|---|---|
| Storage Instructions | Keep as concentrated solution. Aliquot and store at -20ºC or below. Avoid multiple freeze-thaw cycles. |
| Storage Buffer | Phosphate buffered saline (PBS), pH 7.4, 1% BSA and 0.05% NaN3. |
