Application
IHC-Fr analysis of mouse cerebellum using Kv1.2 antibody (green) and Kv1.1 antibody (red). (C) Merge of the two images.Application
WB analysis of rat brain membranes using Kv1.2 antibody at a dilution of 1:200 in the (1) absence or (2) presence of blocking peptide.Application
WB analysis of rat heart membranes using Kv1.2 antibody at a dilution of 1:200 in the (1) absence or (2) presence of blocking peptide.| Product Name | Kv1.2 antibody |
|---|---|
| Antibody Type | Primary Antibodies |
| Product description | Rabbit Polyclonal antibody to Kv1.2delayed-rectifier K+ channel expressed in heart and brain [RGD, Feb 2006] |
| Immunogen | GST fusion protein with sequence YHRETEGEEQAQYLQVTSCPKIPSSPDLKK SRSASTISKSDYMEIQEGVNNSNEDFREENLKTANCTLANTNYVNITKMLTDV, corresponding to amino acid residues 417-499 of rat KV1.2 (Accession P63142). Intracellular, C-terminus. |
| Clonality | Polyclonal |
|---|---|
| Host Species | Rabbit |
| Tested Applications | ICC/IFIHCIHC-FWB |
| Species Reactivity | HumanMouseRat |
| Concentration | 1mg/ml |
| Purification | Affinity purified |
| Gene Synonyms | potassium voltage-gated channel, shaker-related subfamily, member 2 , Kcna2 , BK2 , NGK1 |
|---|---|
| Target | Kv1.2 |
Application
IHC-Fr analysis of mouse cerebellum using Kv1.2 antibody (green) and Kv1.1 antibody (red). (C) Merge of the two images.
Application
WB analysis of rat brain membranes using Kv1.2 antibody at a dilution of 1:200 in the (1) absence or (2) presence of blocking peptide.
Application
WB analysis of rat heart membranes using Kv1.2 antibody at a dilution of 1:200 in the (1) absence or (2) presence of blocking peptide.| Form | Liquid |
|---|---|
| Storage Instructions | Keep as concentrated solution. Aliquot and store at -20ºC or below. Avoid multiple freeze-thaw cycles. |
| Storage Buffer | Phosphate buffered saline (PBS), pH 7.4, 1% BSA, 5% sucrose and 0.025% NaN3. |
