Application
Anti-KV1.6 - Western blot analysis of rat brain membranes: 1. Anti-Kv1.6 antibody, (1:200). 2. Anti-Kv1.6 antibody, preincubated with the control peptide antigen.| Product Name | Kv1.6 antibody |
|---|---|
| Antibody Type | Primary Antibodies |
| Product description | Rabbit Polyclonal antibody to Kv1.6 |
| Immunogen | GST fusion protein with a sequence NYFYHRETEQEEQGQYTHVTCGQPTPDLKATDNGLGKPDFAEAS RERRSSYLPTPHRAYAEKRMLTEV, corresponding to amino acid residues 463-530 of rat Kv1.6 (Accession P17659), (MW: 35 kDa.). Intracellular, C-terminus. |
| Clonality | Polyclonal |
|---|---|
| Isotype | IgG |
| Host Species | Rabbit |
| Tested Applications | ICC/IFIHCWB |
| ICC/IF:1:200~1:500 IHC:1:50~1:200 WB:1:500~1:2000 Notes:Optimal dilutions/concentrations should be determined by the researcher. |
|
| Species Reactivity | MouseRat |
| Concentration | 1mg/ml |
| Purification | Affinity purified |
| Gene Synonyms | Kcna6 potassium voltage gated channel shaker related subfamily member 6 |
|---|---|
| Target | Kv1.6 |
Application
Anti-KV1.6 - Western blot analysis of rat brain membranes: 1. Anti-Kv1.6 antibody, (1:200). 2. Anti-Kv1.6 antibody, preincubated with the control peptide antigen.| Application Notes | ICC/IF:1:200~1:500 IHC:1:50~1:200 WB:1:500~1:2000 Notes:Optimal dilutions/concentrations should be determined by the researcher. |
|---|
| Form | Liquid |
|---|---|
| Storage Instructions | Keep as concentrated solution. Aliquot and store at -20oC or below. Avoid multiple freeze-thaw cycles. |
| Storage Buffer | Reconstituted antibody containsA?phosphate buffered saline (PBS), pH 7.4, 1% BSA, 5% sucrose, 0.025% NaN3. |
