All products Chemokines IP 10 Human

IP 10 Human

Catalog Number:OM301655

Product Profile

Product Name IP 10 Human

Target Information

Source Escherichia Coli.
Sequence Similarities VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKA IKNLLKAVSKEMSKRSP.

Database Links

SwissProt ID P02778

Additional Information

Storage Instructions Lyophilized IP-10 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution CXCL10 should be stored at 4°C between 2-7 days and for future use below -18°C.
Note: The product is for research use only,not for use in diagnostic or therapeutic procedures.

  • Catalog Number: OM301655
  • Price: $388.00
  • Discount Price
  • Size:
  • Store: Out of stock
  • Lead time: 4~6 Week
  • Quantity:
    - +
  • Shipping to (Please select)
Search the catalog number from any major antibody supplier/brand in the search bar above. The search engine will return OmnimAbs products for these targets.

2013 © Omnimabs , All Rights Reserved.