All products Chemokines I TAC Human

I TAC Human

Catalog Number：OM301675

Product Profile

Product Name I TAC Human
Product description 
I-TAC Human Recombinant (Interferon-inducible T-cell alpha chemoattractant) produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 73 amino acids and having a molecular mass of 8300 Dalton.

Target Information

Source Escherichia Coli.
Sequence Similarities FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF.

Database Links

SwissProt ID O14625

Additional Information

Storage Instructions Lyophilized I-TAC although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution I-TAC should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Storage Buffer Lyophilized from a 0.2?m filtered concentrated (0.5mg/ml) solution in 20mM PB, pH 7.4, 100mM NaCl.
Note: The product is for research use only,not for use in diagnostic or therapeutic procedures.

Submit an review for OM301675
Submit an review for OM301675
  • Catalog Number: OM301675
  • Price: $388.00
  • Discount Price
  • Size:
  • Store: Out of stock
  • Lead time: 4~6 Week

  • Quantity:
    - +
  • Shipping to (Please select)
Add to cart
Add to Wishlist
Search the catalog number from any major antibody supplier/brand in the search bar above. The search engine will return OmnimAbs products for these targets.
PRODUCT CATEGORIES
Primary antibodies Secondary antibodies Tags antibodies Flow cytometry antibodies
SUPPORT
Catalogs Newsletter Order Online Buying FAQs Distributor
COMPANY
Profile Strategy Careers
CONTACT
Contact us

2013 © Omnimabs , All Rights Reserved.