All products Chemokines MCP 4 Human

MCP 4 Human

Catalog Number:OM301719

Product Profile

Product Name MCP 4 Human
Product description
Monocyte Chemotactic Protein-4 Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 75 amino acids and having a molecular mass of 8.6 kDa. The MCP-4 is purified by proprietary chromatographic techniques.

Target Information

Source Escherichia Coli.
Sequence Similarities QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAV

Database Links

SwissProt ID Q99616

Additional Information

Storage Instructions Lyophilized MCP-4 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution MCP-4 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Storage Buffer The protein was lyophilized from a concentrated (1mg/ml) sterile solution in 20mM PB, pH 7.4, 130mM NaCl.
Note: The product is for research use only,not for use in diagnostic or therapeutic procedures.

  • Catalog Number: OM301719
  • Price: $388.00
  • Discount Price
  • Size:
  • Store: Out of stock
  • Lead time: 4~6 Week
  • Quantity:
    - +
  • Shipping to (Please select)
Search the catalog number from any major antibody supplier/brand in the search bar above. The search engine will return OmnimAbs products for these targets.

2013 © Omnimabs , All Rights Reserved.