MECP2 Human

Product Profile

Product Name	MECP2 Human
Product description	MECP2 Human Recombinant is expressed in 293 cells. The protein contains 486 amino acids (1-486a.a.) and fused to an N-terminal Flag tag, having an Mw of 53.56kDa.

Target Information

Source	Mammalian system, 293 cells.
Sequence Similarities	MVAGMLGLREEKSEDQDLQGLKDKPLKFKKVKKDKKEEKEGKHEPVQPSAHHSA

Additional Information

Storage Instructions	MECP2 although stable 4°C for 4 weeks, should be stored below -18°C.
Storage Buffer	The MECP2 solution (0.45mg/ml) contains 50mM Tris, 135mM NaCl, 20% Glycerol, pH 7.5 and 200µg/ml FLAG peptide.

• Question type：
• Enter the charactors： Generate another
• Submit the question

• Data sheet for OM302690