TFF1 Human

Product Profile

Product Name	TFF1 Human
Product description	TFF-1 Human Recombinant produced in E.Coli is a homodimer, non-glycosylated, polypeptide chain containing 2 x 60 amino acids which includes a 40 amino acid trefoil motif containing 3 conserved intramolecular disulfide bonds and having a total molecular mass of 13.2 kDa.

Target Information

Source	Escherichia Coli.
Sequence Similarities	EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFY

Database Links

SwissProt ID	P04155

Additional Information

Storage Instructions	Lyophilized TFF1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TFF1 should be stored at 4°C between 2-7 days and for future use below -18°C.
Storage Buffer	The Human TFF1 protein was lyophilized from a 0.2µm filtered concentrated solution in 20mM PB, pH 7.4 and 150mM NaCl.

• Question type：
• Enter the charactors： Generate another
• Submit the question

• Data sheet for OM297410