TGFB2 Human

Product Profile

Product Name	TGFB2 Human
Product description	TGFB2 Human Recombinant produced in plants is a homodimeric polypeptide chain containing 2 x 118 amino acids and having a total molecular mass of 27.08kDa. The TGFB2 is fused to 6xHis Tag at N-terminus and purified by proprietary chromatographic techniques.

Target Information

Source	Nicotiana benthamiana.
Sequence Similarities	ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIH

Database Links

SwissProt ID	P61812

Additional Information

Storage Instructions	Lyophilized TGFB2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TGFB2 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Storage Buffer	Lyophilized from a concentrated (1mg/ml) solution containing 50mM Tris-HCl pH-7.4.

• Question type：
• Enter the charactors： Generate another
• Submit the question

• Data sheet for OM301483