TGF b 3 Human, Plant

Product Profile

Product Name	TGF b 3 Human, Plant
Product description	TGFB3 Human Recombinant produced in plant is a disulfide-linked homodimeric, glycosylated, polypeptide chain containing 118 amino acids and having a molecular mass of 27.2kDa.

Target Information

Source	Nicotiana benthamiana.
Sequence Similarities	HHHHHALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKG

Database Links

SwissProt ID	P10600

Additional Information

Storage Instructions	Lyophilized TGFB3 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution TGFB3 Human should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Storage Buffer	Lyophilized from a concentrated (1mg/ml) solution containing 50mM Tris-HCl pH-7.4.

• Question type：
• Enter the charactors： Generate another
• Submit the question

• Data sheet for OM301471