All products Enzymes p16-INK4a Human

p16-INK4a Human

Catalog Number:OM300261

Product Profile

Product Name p16-INK4a Human
Product description
CDKN2A Human Recombinant produced in E.Coli, it's a single non-glycosylated polypeptide chain containing 156 amino acids, approximately 16.5 kDa.

Target Information

Source Escherichia Coli.
Sequence Similarities MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVM

Database Links

SwissProt ID P42771

Additional Information

Storage Instructions Lyophilized Cyclin-dependent kinase although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Cyclin-dependent kinase should be stored at 4°C between 2-7 days and for future use below -18°C.
Storage Buffer CDKN2A was lyophilized from a concentrated (1mg/ml) sterile solution containing 1x PBS pH-7.4.
Note: The product is for research use only,not for use in diagnostic or therapeutic procedures.

  • Catalog Number: OM300261
  • Price: $388.00
  • Discount Price
  • Size:
  • Store: Out of stock
  • Lead time: 4~6 Week
  • Quantity:
    - +
  • Shipping to (Please select)
Search the catalog number from any major antibody supplier/brand in the search bar above. The search engine will return OmnimAbs products for these targets.

2013 © Omnimabs , All Rights Reserved.