Application
IHC-P analysis of ovarian tissue section from a 25 day old mouse using AMH antibody [5/6].| Product Name | AMH antibody [5/6] |
|---|---|
| Antibody Type | Primary Antibodies |
| Product description | Mouse monoclonal antibody [5/6] to AMHAnti-Mullerian hormone is a member of the transforming growth factor-beta gene family which mediates male sexual differentiation. Anti-Mullerian hormone causes the regression of Mullerian ducts which would otherwise differentiate into the uterus and fallopian tubes. Some mutations in the anti-Mullerian hormone result in persistent Mullerian duct syndrome. [provided by RefSeq, Jul 2008] |
| Immunogen | Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC) |
| Clonality | Monoclonal |
|---|---|
| Isotype | IgG1 |
| Clone Number | 5/6 |
| Host Species | Mouse |
| Tested Applications | IHCIHC-PWB |
| WB:1:500~1:2000 IHC:1:50~1:200 |
|
| Species Reactivity | BaboonHumanMonkeyMouseRatSheep |
| Concentration | 1mg/ml |
| Purification | Affinity purified |
| Gene Synonyms | MIF , anti-Mullerian hormone , MIS |
|---|---|
| Target | AMH |
| Tissue Specificity | This antibody recognizes human anti-mullerian hormone (AMH). |
Application
IHC-P analysis of ovarian tissue section from a 25 day old mouse using AMH antibody [5/6].| Application Notes | WB:1:500~1:2000 IHC:1:50~1:200 |
|---|
| Form | Liquid |
|---|---|
| Storage Instructions | Store at +4°C or at -20°C if preferred. This product should be stored undiluted. Storage in frost-free freezers is not recommended. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use. |
| Storage Buffer | Tissue culture supernatant with 0.1% sodium azide. |
