Application
WB analysis of GDF9 over expressing lysate using GDF9 antibody [mAb-GDF9-53].| Product Name | GDF9 antibody [mAb-GDF9-53] |
|---|---|
| Antibody Type | Primary Antibodies |
| Product description | Mouse monoclonal antibody [mAb-GDF9-53] to GDF9 |
| Immunogen | Tuberculin coupled synthetic peptide VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC from near the C-terminal region of mature human GDF9. |
| Clonality | Monoclonal |
|---|---|
| Isotype | IgG |
| Clone Number | mAb-GDF9-53 |
| Host Species | Mouse |
| Tested Applications | IHC-FIHC-PWBFunctional Assay |
| Western Blotting: 1/100 - 1/1000 | |
| Species Reactivity | HumanMouseSheep |
| Concentration | 1mg/ml |
| Purification | Affinity purified |
| Gene Synonyms | GDF-9 , growth differentiation factor 9 |
|---|---|
| Target | GDF9 |
| Tissue Specificity | This antibody recognizes GDF9 and has been shown to neutralize GDF9 biological activity (Gilchrist et al. 2004, Dragovic et al. 2005). |
Application
WB analysis of GDF9 over expressing lysate using GDF9 antibody [mAb-GDF9-53].| Application Notes | Western Blotting: 1/100 - 1/1000 |
|---|
| Form | Liquid |
|---|---|
| Storage Instructions | Store at +4°C or at -20°C if preferred. Storage in frost-free freezers is not recommended. This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use. |
| Storage Buffer | Phosphate buffered saline containing 0.09% Sodium Azide (NaN3) |
