Application
Immunohistochemistry analysis of human spleen tissue stained with HO-1, mAb (HO-1-1) at 10µg/ml.Application
Western blot analysis of HO-1 (Hsp32), mAb (HO-1-1) Lane 1: MW marker Lane 2: HO-1 (rat), (recombinant) Lane 3: HO-1 (human), (recombinant) Lane 4: HO-2 (human), (recombinant) Lane 5: MDBK cell lysate Lane 6: Dog liver microsome Lane 7: Mouse liver microsome.| Product Name | Heme Oxygenase 1 antibody |
|---|---|
| Antibody Type | Primary Antibodies |
| Product description | Mouse monoclonal [HO-1-1] to Heme Oxygenase 1Heme oxygenase (HO) is a microsomal enzyme that catalyzes the oxidation of heme to the antioxidant molecules, biliverdin and carbon monoxide. HO consists of two homologous isozymes, an inducible HO1 and a constitutively expressed HO2. HO1 is induced by a wide variety of stimuli including conditions of oxidative stress, inflammatory agents, transforming growth factor beta and heat shock. The increase in expression of HO1 is thought to be a cellular defense mechanism against oxidative stress since elevated HO could eventually generate more bilirubin, an anti-oxidant. |
| Immunogen | Synthetic peptide: MERPQPDSMPQDLSEALKEATKEVHTQAEN, corresponding to amino acids 1-30 of Human Heme Oxygenase 1. |
| Clonality | Monoclonal |
|---|---|
| Isotype | IgG1 |
| Clone Number | HO-1-1 |
| Host Species | Mouse |
| Tested Applications | FACSIHCWB |
| For FACS: Use at a concentration of 10 μg/ml. Foe WB: Use at a concentration of 4 μg/ml. Detects a band of approximately 32 kDa. Optimal dilutions/concentrations should be determined by the end user.: |
|
| Species Reactivity | HumanMouseDogRatBovine |
| Concentration | 1mg/ml (Please refer to the vial label for the specific concentration) |
| Purification | Protein G |
| Gene Synonyms | Heme Oxygenase 1 141250 3162 HO1 Heme Oxygenase1 P09601 HO-1 HMOX1 bK286B10 HO 1 |
|---|---|
| Target | Heme Oxygenase 1 |
Application
Immunohistochemistry analysis of human spleen tissue stained with HO-1, mAb (HO-1-1) at 10µg/ml.
Application
Western blot analysis of HO-1 (Hsp32), mAb (HO-1-1) Lane 1: MW marker Lane 2: HO-1 (rat), (recombinant) Lane 3: HO-1 (human), (recombinant) Lane 4: HO-2 (human), (recombinant) Lane 5: MDBK cell lysate Lane 6: Dog liver microsome Lane 7: Mouse liver microsome.| Positive Control | Recombinant Human or Rat HO-1 (Hsp32) Protein |
|---|---|
| Application Notes | For FACS: Use at a concentration of 10 μg/ml. Foe WB: Use at a concentration of 4 μg/ml. Detects a band of approximately 32 kDa. Optimal dilutions/concentrations should be determined by the end user.: |
| Form | Liquid |
|---|---|
| Storage Instructions | Upon receipt - Keep as concentrated solution. Aliquot and store at -20ºC or below. Avoid freeze-thaw cycles. |
| Storage Buffer | Phosphate-buffered saline containing 0.09% sodium azide and 50% glycerol |
