Application
Mouse thymus IL21R N term| Product Name | IL21 Receptor antibody |
|---|---|
| Antibody Type | Primary Antibodies |
| Product description | Rabbit polyclonal to IL21 ReceptorThe protein encoded by this gene is a cytokine receptor for interleukin 21 (IL21). It belongs to the type I cytokine receptors, and has been shown to form a heterodimeric receptor complex with the common gamma-chain, a receptor subunit also shared by the receptors for interleukin 2 (IL2) and interleukin 5 (IL5). This receptor transduces the growth promoting signal of IL21, and is important for the proliferation and differentiation of T cells, B cells, and natural killer (NK) cells. The ligand binding of this receptor leads to the activation of multiple downstream signaling molecules, including JAK1, JAK3, STAT1, and STAT3. Knockout studies of a similar gene in mouse suggest a role for this gene in regulating immunoglobulin production. Three alternatively spliced transcript variants encoding the same protein have been described. |
| Immunogen | Synthetic peptide: CVLETRSPNPSILSLTWQDEYEELQDQETF, corresponding to N-term amino acids 35-65 of Mouse IL21 Receptor. |
| Clonality | Polyclonal |
|---|---|
| Isotype | IgG |
| Host Species | Rabbit |
| Tested Applications | ELISAFACSIHC |
| For ELISA (peptide): Use at a dilution of 1:100,000. For FACS: Use at a dilution of 1:20. For IHC: Use at a dilution of 1:300. Optimal dilutions/concentrations should be determined by the researcher.: |
|
| Species Reactivity | Mouse |
| Concentration | 1mg/ml (Please refer to the vial label for the specific concentration) |
| Purification | Affinity purified |
| Gene Synonyms | IL21 R IL21R NILR |
|---|---|
| Target | IL21-R |
Application
Mouse thymus IL21R N term| Positive Control | Mouse thymus/spleen |
|---|---|
| Application Notes | For ELISA (peptide): Use at a dilution of 1:100,000. For FACS: Use at a dilution of 1:20. For IHC: Use at a dilution of 1:300. Optimal dilutions/concentrations should be determined by the researcher.: |
| Form | Liquid |
|---|---|
| Storage Instructions | Keep as concentrated solution. Store at 4ºC short term. For extended storage aliquot and store at -20ºC or below. Avoid freeze-thaw cycles. |
| Storage Buffer | 10 mM KHPO4, 140 mM NaCl containing 0.1 % sodium azide |
