| Product Name | Inhibin beta C chain antibody |
|---|---|
| Antibody Type | Primary Antibodies |
| Product description | Mouse monoclonal antibody [betaC clone 1] to Inhibin beta C chainThis gene encodes the beta C chain of inhibin, a member of the TGF-beta superfamily. This subunit forms heterodimers with beta A and beta B subunits. Inhibins and activins, also members of the TGF-beta superfamily, are hormones with opposing actions and are involved in hypothalamic, pituitary, and gonadal hormone secretion, as well as growth and differentiation of various cell types. [provided by RefSeq, Jul 2008] |
| Immunogen | Synthetic peptide sequence VPTARRPLSLLYYDRDSNIVKTDIPDMVVEAC corresponding to amino acids 82-113 of mature human Inhibin beta C chain. |
| Clonality | Monoclonal |
|---|---|
| Isotype | IgG1 |
| Clone Number | betaC clone 1 |
| Host Species | Mouse |
| Tested Applications | ELISAIHC-PWB |
| Western Blotting: Max Dilution 1/5000 Optimal dilution / concentration should be determined by the end user.: |
|
| Species Reactivity | HumanRat |
| Concentration | 1mg/ml |
| Purification | Affinity purified |
| Gene Synonyms | INHBC IHBC |
|---|---|
| Target | Inhibin beta C chain |
| Tissue Specificity | This antibody recognizes Inhibin beta C chain. Clone betaC clone 1 has been shown to recognize both monomeric and dimeric Activin beta C and does not cross react with beta A, beta B or beta E. |
| Application Notes | Western Blotting: Max Dilution 1/5000 Optimal dilution / concentration should be determined by the end user.: |
|---|
| Form | Liquid |
|---|---|
| Storage Instructions | Store at +4°C or at -20°C if preferred. Storage in frost-free freezers is not recommended. This product should be stored undiluted. Avoid repeated freezing and thawing as this may denature the antibody. Should this product contain a precipitate we recommend microcentrifugation before use. |
| Storage Buffer | Phosphate buffered saline containing 0.09% Sodium Azide (NaN3) |
