Application
WB analysis of Kv11.1 expressing HEK293 lysates using Kv11.1 antibody at a dilution of 1:400 in the (1) absence or (2) presence of blocking peptide.Application
ICC/IF analysis of Kv11.1 transfected HEK293 cells using Kv11.1 antibody (red). Arrows indicate cells that do not express the channel.Application
IP analysis was performed with Kv11.1 expressing HEK293 lysates and Kv11.1 antibodies (lane 2), (lane 3), (lane 4) or pre-immune serum (lane 5). Control lysate (lane 1) and the precipitates were detected by . Red arrow indicates Kv11.1 while the black arrow shows the IgG heavy chain.| Product Name | Kv11.1 antibody |
|---|---|
| Antibody Type | Primary Antibodies |
| Product description | Rabbit Polyclonal antibody to Kv11.1This gene encodes a voltage-activated potassium channel belonging to the eag family. It shares sequence similarity with the Drosophila ether-a-go-go (eag) gene. Mutations in this gene can cause long QT syndrome type 2 (LQT2). Transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Jul 2008] |
| Immunogen | GST fusion protein with sequence DSLSQVSQFMACEELPPGAPELPQEGPTRRLSLPGQLGALTSQ PLHRHGSDPGS, corresponding to amino acid residues 1106-1159 of human Kv11.1 (HERG) (Accession Q12809), (MW: 35 kDa.). Intracellular, C-terminus. |
| Clonality | Polyclonal |
|---|---|
| Host Species | Rabbit |
| Tested Applications | ICC/IFIHCIPWB |
| ICC/IF:1:200~1:500 IHC:1:50~1:200 IP:1:100~1:500 WB:1:500~1:2000 Notes:Optimal dilutions/concentrations should be determined by the researcher. |
|
| Species Reactivity | HumanMouseRat |
| Concentration | 1mg/ml |
| Purification | Affinity purified |
| Gene Synonyms | HERG ERG1 HERG1 LQT2 KCNH2 potassium voltage-gated channel subfamily H (eag-related) member 2 SQT1 |
|---|---|
| Target | Kv11.1 |
| Tissue Specificity | The antibody recognizes the HERG1b splice variant but not splice variants HERG1-3 and HERG-4 |
Application
WB analysis of Kv11.1 expressing HEK293 lysates using Kv11.1 antibody at a dilution of 1:400 in the (1) absence or (2) presence of blocking peptide.
Application
ICC/IF analysis of Kv11.1 transfected HEK293 cells using Kv11.1 antibody (red). Arrows indicate cells that do not express the channel.
Application
IP analysis was performed with Kv11.1 expressing HEK293 lysates and Kv11.1 antibodies (lane 2), (lane 3), (lane 4) or pre-immune serum (lane 5). Control lysate (lane 1) and the precipitates were detected by . Red arrow indicates Kv11.1 while the black arrow shows the IgG heavy chain.| Application Notes | ICC/IF:1:200~1:500 IHC:1:50~1:200 IP:1:100~1:500 WB:1:500~1:2000 Notes:Optimal dilutions/concentrations should be determined by the researcher. |
|---|
| Form | Liquid |
|---|---|
| Storage Instructions | Keep as concentrated solution. Aliquot and store at -20ºC or below. Avoid multiple freeze-thaw cycles. |
| Storage Buffer | Phosphate buffered saline (PBS), pH 7.4, 1 % BSA and 0.025% NaN3. |
